DPCstruct | MC8060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 190 ± 31 aa |
| Standard deviation of domain lengths | 31.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J9Q0N1 | 1-134 | MSIDKAAQSRILRGFQSEAEPHVMKIIWARGDSQANAVSQLHKVNQKIEAWNREHNLWIADGTFDIEDFIAINRAIELAIKGYDPKA… |
| B8M0B8 | 60-243 | EQLLWGDHSERQSAKERIDQVNEEIRAFNITCNRNEECGTIDGIDWIRAGRQLDLAVRDKCFYNSTARFEDVRDFIWERIQNRTYPE… |
| A0A0U5GK62 | 2-141 | None |
| A0A7C8H5U8 | 2-180 | None |
| C4K0A9 | 3-159 | None |
| A0A1L9U3S4 | 5-185 | None |
| A0A5N6X1M7 | 255-473 | None |
| A6RD93 | 1-204 | None |
| A0A5M9MJD3 | 1-232 | None |
| A0A5M9MDK6 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.