DPCstruct | MC806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 121 ± 13 aa |
| Standard deviation of domain lengths | 13.11 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20383 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3JZW5 | 140-263 | QNDKNRKTIQTTVAARNLAGAANNTKWNELITHMRQRSEWVPSYRSKCITGHISGWDVEWFYHLPFPFAYVEWLDIGVWQEAPSLGV… |
| A0A509MI88 | 1-130 | MAPEIWKRFFETCCEVLGVGSHVAMRSDNWCSWTTYDRLTLDAEYWSSGLPTAKEIGDIGIGDGGVWGQPFSYSQIAHLIVPRKFYW… |
| A0A4P8N025 | 1-106 | None |
| A0A1H0LLL6 | 24-136 | None |
| A0A2Z3HCE4 | 1-125 | None |
| A0A660NCK7 | 1-124 | None |
| A0A1B6ZAP3 | 10-106 | None |
| A0A1Y5GS02 | 8-148 | None |
| A0A6G4R1P8 | 3-140 | None |
| A0A0M9EI01 | 6-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.