DPCstruct | MC8058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 8.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8MM83 | 76-152 | DKSRAGEYSIRFGQGDSVDSEGAITIKTPIGNVDFHVMNTPTPFLLCIANMDHHEAYLDNTTNCLVKGDLRVLIVWK |
| B8MJQ1 | 33-115 | DTLTTRAASIRFSAGEPLQSLDSIDIKTPISTVQFHIVKAMTPFLLCIKDLDHLKVYYNNTKNLLVRNEPPLTKTNAFSQPPN |
| A0A656KJ66 | 230-306 | None |
| A0A0C3DZ86 | 164-252 | None |
| A0A395IIK5 | 529-617 | None |
| A0A395IDI2 | 373-447 | None |
| A0A6S6W1Q9 | 280-377 | None |
| A0A0B1PCJ5 | 505-602 | None |
| B8MM19 | 187-263 | None |
| A0A4V6DHS4 | 210-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.