DPCstruct | MC8057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 222 ± 46 aa |
| Standard deviation of domain lengths | 45.64 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 11.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L8RLJ4 | 101-345 | ALEVRIAPTSTRLDLKTYTQILNEVRMSLEEVDRTALPVRTPRLRWAIEEMAMESDIRIVLVPAVIPTKRTWQSIAAPLHGYVDGIE… |
| A0A1E4IML4 | 4-230 | YFQDLVSRAFASNELGSLGERGPIPKRQATDLMVTQLTRGSFGFVLDELSDQAELEDTALKAMVEEIVTIVEKVASSNEIDFEEVAE… |
| A0A5C8G8B8 | 1-209 | None |
| M6G6B9 | 182-450 | None |
| A0A651ETA8 | 1-172 | None |
| A0A4U3L3S4 | 14-207 | None |
| A0A377R4P1 | 9-226 | None |
| A0A3C1L5F3 | 2-157 | None |
| A0A7G6Z0Q6 | 50-318 | None |
| A0A5A7NKJ2 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.