DPCstruct | MC8055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 145 |
|---|---|
| Mean domain length (aa) | 126 ± 15 aa |
| Standard deviation of domain lengths | 15.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7W691 | 2-120 | RCPKCGGTMMVLNRNGVSIEQCQMCKGIYLDNGEIEALKQREGFAAVVQASMPTPGNQPPPGPGVTCPKCAGLMRHYNRNGVGIEQC… |
| A0A136KP92 | 2-106 | HCPNCHHILVKVLLDSVEVDHCNFCGATLFDMNEINRITLTDARRLAEMKQSDVISGEEKLSPRDGSPLVRITNDAIPQFVTILHSP… |
| A0A7V9L315 | 177-271 | None |
| A0A7V9L350 | 2-106 | None |
| A0A7V9RCP4 | 6-133 | None |
| A0A1Q7HQA1 | 2-121 | None |
| A0A523E8Q5 | 151-275 | None |
| A0A381R9Z0 | 1-118 | None |
| A0A1V4RAG3 | 2-159 | None |
| A0A1P8WNY5 | 72-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.