DPCstruct | MC8054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 16.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7HV86 | 5-145 | DLILKGYDEAFLRLGTQRNDAKINGDSESLYIPLVETLGWADVIEEYFDERFGKDWMLKLPNSKTDYEQVILGFRYVRNVVHHRWAV… |
| A0A7W7RMT1 | 1-158 | MPSMHDPLLMLNLALEGFRTAKHRYEGSDSSKYAYEVFVPLAEALWWARSVDEGFENLDGDPYKAERDAHASGRVLPGLRFARNRTN… |
| A0A5C8UQC6 | 26-178 | None |
| H6RVF4 | 1-150 | None |
| A0A2T7KJ86 | 7-199 | None |
| A0A1G9R2M6 | 1-172 | None |
| H5US99 | 12-183 | None |
| A0A4Q7KFQ0 | 37-222 | None |
| A0A838SKP1 | 130-284 | None |
| A0A6P2BQ39 | 40-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.