DPCstruct | MC8053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 7.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8F0Q6 | 2-67 | LSRIAGDQPVALNQAFVGQCISVGRSYGTIQLAHTDDTPVNVIIGGRAGAAVKEAICKGTLWALRR |
| A0A7W7RJ14 | 11-90 | ARAVRTIAGRRAGRTPPPMRFRYFTRCLGPGRRDGLIRFVHAGGSPRPTALTGRAAARYKETVVRGTVLGMRRSGVLTLL |
| A0A1A1Y3T8 | 50-128 | None |
| A0A0N0XSJ5 | 12-79 | None |
| A0A291T5K9 | 90-174 | None |
| A0A0U0W430 | 296-363 | None |
| A0A6L5F5B5 | 10-97 | None |
| A0A1U1F466 | 11-94 | None |
| A0A316IEX6 | 2-75 | None |
| A0A6I8LQ76 | 37-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.