DPCstruct | MC805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 127 ± 13 aa |
| Standard deviation of domain lengths | 13.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P9K339 | 1-126 | MSEVFVSAVHPNIGRLYWAYTPADVGYPDHYTITDWSELATKLPNGWRDHDYLHWRHKSHIYKVFDPDDAFADYAVDDDEENEIHEQ… |
| A0A0G4E5B2 | 1-138 | MKPQVMISAVHPVLGRLYWVYVSNACCNAPDYFGVTMHRSSAMLLPQGWRTDDFLQWRHKGHMYTVFEENQYGSDYWVEEDDETGEL… |
| A0A2P0QF15 | 180-305 | None |
| A0A3M3FTS9 | 31-166 | None |
| A0A811H0L3 | 10-151 | None |
| A0A0H3I9I8 | 3-109 | None |
| A0A763Z2A6 | 1-98 | None |
| A0A3G7C8F0 | 1-146 | None |
| A0A6H1Q9Z0 | 8-129 | None |
| A0A1T1IYH4 | 16-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.