DPCstruct | MC8046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 95 ± 13 aa |
| Standard deviation of domain lengths | 13.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.65 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0063- PF12769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7V7H2 | 3-81 | DGFVALYIFMLAAIAGHVIISRVPVILHTPLMSGSNFIHGIVLIGAMVVLGHADTTLEKALGFVAVVLGAGNAAGGYVV |
| A0A2E3NNC1 | 2-81 | LAAFTGYEIIGKVPAILHTPLMSGSNFVHGIVLVGAMVALGHADTILEQTIGFLGVVLAAGNAVGGYVVTERMLEMFKSS |
| A0A0M8WBK6 | 10-101 | None |
| A0A2E4QUZ7 | 19-130 | None |
| A0A7M3RW15 | 133-257 | None |
| A0A0G1DTI7 | 5-99 | None |
| A0A2G2LR81 | 8-112 | None |
| A0A538T2B2 | 33-134 | None |
| A0A522WB74 | 2-88 | None |
| A0A7S0TYV4 | 15-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.