DPCstruct | MC8044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 201 ± 27 aa |
| Standard deviation of domain lengths | 27.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3N1N3 | 20-204 | RPPLPLRGLRPLNRRGSLADVCAYIDTDAIASTNILGVSLDALAGVDVCLCLSALPLYLGTNVGASALVDTLGVNTLTSAFTQLIVG… |
| A0A0D0DF16 | 8-192 | TPLLLASASFAGSPQSRAPHRRAQHTDVCANIDADLVFPDVIIDGKAYVAGQIDIGLCVSQVTVFVGHYNVTEAAVKVVGKDKVEST… |
| A0A4R0RKS7 | 29-207 | None |
| A0A284RKG0 | 1-221 | None |
| A0A4S4KZ04 | 2-218 | None |
| A0A0D7BGX1 | 2-227 | None |
| A0A067PJ17 | 1-181 | None |
| M2PJQ5 | 1-202 | None |
| A0A427YNK3 | 26-282 | None |
| A0A4Y9Z9N1 | 527-755 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.