DPCstruct | MC8043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 184 ± 20 aa |
| Standard deviation of domain lengths | 19.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07217 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7LVK6 | 10-180 | GKKWTSMLIKRTYFGNWLRDYSQAVDIGSLKGVNAETIRILVWVLSFMAHGYATGEFEVTADRLGVYRPEEHIDNPLGYGDGVDART… |
| A0A2S6C5N3 | 2-179 | DVVLTLTNARAFSSGLLGRPKKFSKLDVSRLYFGNWLRDYSQAVDVESVRFVSAEAVVLVVWILEFMSFGYGTGEFEVTKERLGVYI… |
| X8JL81 | 421-640 | None |
| A0A2R6NEW7 | 2-190 | None |
| A0A0B1P3R4 | 14-169 | None |
| A0A5B0MXS6 | 1-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.