DPCstruct | MC8041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9P8Z5 | 1-118 | MKIGNSHSWNYNNGKWFETKITPEKWNFTFNSVKTRHNLAPTNSGASIGTKYHWYIIADQIATKIDPNSYETEMKGIKLKVGHKRPY… |
| A0A5C3MTF9 | 102-277 | GGYDALKSFNGQMYSGMSIGGSHTWNYDQGVWKETKEEPDLWRVEYETTKRRARKAPKGSGAPVGTEYHWLIVAHQVWYVLDTWDRT… |
| A0A822JAG3 | 1-143 | None |
| A0A370CEK5 | 1-135 | None |
| A0A261XUD0 | 225-375 | None |
| A0A505I755 | 88-228 | None |
| A0A7J2YS01 | 11-156 | None |
| A0A225AB79 | 72-223 | None |
| A0A2D8IZD9 | 12-154 | None |
| A0A537IFF7 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.