DPCstruct | MC804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 9.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I8DQN1 | 107-201 | TGRLWLGAIAGVYVCLAVVDHATFFRDPSATRKVAPALAGEQRACVGDVLLVRLDDDVAEYRCPTSVLLGRHYREVFAPWPGYDAGS… |
| A0A0G4E4H3 | 2-107 | LAGVVLVGAVSAISHLTFFSSWKDGIANIEFVRDDVQLKDMANCTGGVAFIQYREDGGALHYRCPTLMMFGGYTSQPFAPWPDYVEG… |
| A0A4Q7V7B5 | 91-181 | None |
| A0A4Q6DQH5 | 46-144 | None |
| A0A1J0EUV2 | 2-79 | None |
| A0A3Q9DAF4 | 4-109 | None |
| A0A5H2Z3R1 | 16-121 | None |
| A0A125K3K1 | 122-214 | None |
| A0A1S6KRX7 | 23-127 | None |
| A0A7U2LLU5 | 135-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.