DPCstruct | MC8039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 143 ± 20 aa |
| Standard deviation of domain lengths | 19.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4K3T7 | 56-177 | SRTLSLLQAYFEMLKRSFMLPRSVDIGCASWTLQHDAARVTSASVISALRVLEEKRIPEHERGKLSFTPLNEPVHRYIEDLDRLVVH… |
| A0A5C3MNX9 | 1-173 | MSAEVDRLEATLSQILNAFVPPALIDVVGPRGELIAVALSEADSAAKVWPPGRALPADAPTLPHTTNNAPIHAFTDRLSRLLEELDG… |
| A0A165ZRE0 | 88-218 | None |
| A0A2R6NYA6 | 322-477 | None |
| A0A4V6S1V8 | 244-404 | None |
| A0A067T5I3 | 246-371 | None |
| W4K3E4 | 82-237 | None |
| A0A0D7BVC9 | 179-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.