DPCstruct | MC8038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 225 ± 21 aa |
| Standard deviation of domain lengths | 21.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3MNN3 | 29-278 | FRRVFVPFNGRKKKANAASDLASRWCDICGRDITVGTGGDVNWEHHLRSKNHADNDKLNGPKFKKLTAWFTHPQSSRNVSASSSTLT… |
| A0A165LZP4 | 20-230 | PDNTVECRRCKASVQLGSVGYPNYTKRHYRTKQCDKNFKKENERSLLAKAKERGKLWFAPKPKAVPSTVHAPALMQPSTSAQAQVES… |
| V2WPW3 | 2-264 | None |
| A0A4S8KUQ7 | 128-327 | None |
| A0A4S8LKV2 | 8-200 | None |
| B0D383 | 25-246 | None |
| A0A0C9YAY2 | 4-229 | None |
| A0A4S8L096 | 395-613 | None |
| A0A6A4GU24 | 1-187 | None |
| A0A166QZ04 | 12-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.