DPCstruct | MC8036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 179 ± 18 aa |
| Standard deviation of domain lengths | 18.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.31 |
| Pfam Score | 95.24 |
| Assigned Pfam label(s) | PF01052- PF16973 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7YYI9 | 305-483 | LAHERSNLPALTKSLLSWELLLSEGLVLLAASEIEEVEPGDTLIYTPASRLILPPAPKSADARRGWQVSRSEEKPLHFVVRTFCEWG… |
| A0A120G8R3 | 3-173 | AQFRLAVDVTLGHLRLSMHQLRGLRTGDVLVLERAFFSASGTGHVQVGKQRLVGWIDAESGPMRLTLTSIEDMFVDEDFATQPYSEH… |
| A0A0A2WL61 | 67-269 | None |
| A0A0P9P091 | 8-189 | None |
| A0A4U9HTC1 | 14-218 | None |
| A0A2G6T3J2 | 122-279 | None |
| A0A2A2KJC7 | 416-567 | None |
| A0A1V5TD29 | 57-245 | None |
| A0A3D1C8L6 | 12-189 | None |
| A0A848FGY3 | 145-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.