DPCstruct | MC8035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 310 ± 30 aa |
| Standard deviation of domain lengths | 29.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381C4G8 | 6-321 | ITIWEGCDPTITTAIKIFIERGSPYSIASRRYPILRLVQEVIYPAVAAYINSLPLSHKDYISGADIGFSELIKKVGFNVVAQAQKLL… |
| A0A4Q7YUN7 | 1-379 | MSISAVDTVIYLLTCDRATVAKEILFKSRCYYLIDMVDRKKPLNRPDADPIQIYRGCNSRVASAVNMFSRQWARYSVRSRRYPIYVL… |
| A0A7X4W084 | 1-286 | None |
| A0A1I3ZW83 | 117-421 | None |
| A0A243T3Z9 | 5-314 | None |
| A0A5Q0BT10 | 89-398 | None |
| A0A5Q0BJ63 | 148-467 | None |
| A0A4Q7MZI2 | 4-286 | None |
| A0A7U7EQZ0 | 13-357 | None |
| A0A6M4FJ67 | 1-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.