DPCstruct | MC8034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 181 ± 24 aa |
| Standard deviation of domain lengths | 24.11 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E3PT50 | 1-153 | MADEKSKSPLECLNDVSTEKDILGFQPYVEAIAEFLTAEGTQPPITLSIEGEWGCGKSSFMKQLEKEIRKKNESGKETKYFTVWFNS… |
| A0A4Q7YQT8 | 17-223 | LVAEEAAKDHSDGGDPDESTKTPDSSSNEASVGAAGLRDMPTDQDELGFGIYVESVAAFLTHKDTKPPLTMSIEGAWGCGKSSFMSQ… |
| A0A3M2CT25 | 109-288 | None |
| H8MQV9 | 7-152 | None |
| A0A1X1QV54 | 56-215 | None |
| A0A2G5QJG1 | 2-204 | None |
| A0A0V8A027 | 1-213 | None |
| A0A6P0P7K8 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.