DPCstruct | MC8032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 383 |
|---|---|
| Mean domain length (aa) | 93 ± 15 aa |
| Standard deviation of domain lengths | 15.11 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.53 |
| Pfam Score | 87.63 |
| Assigned Pfam label(s) | PF21258- CL0202- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A261Q3C6 | 15-104 | STLLQAQVNYYVSADGNDDGNTGLSQQSPWKTLAKVNTMAATFNPGDSILFRRGDVFRGELLPQKSGTATASITYGAYGTGSRPIIN… |
| A0A5E8NLJ6 | 2-75 | QIHVAKTGNDHHDGTAEHPLLTINHAAQIAQPGDTVIVHEGEYREWVNPKNAGLSDRRRIVYQAAPREKVVIKG |
| A0A7C2MSG6 | 115-180 | None |
| A0A6C2U8X8 | 203-296 | None |
| A0A5C5YZY8 | 29-106 | None |
| A0A7V3ACV4 | 300-379 | None |
| A0A5C5YWW8 | 20-112 | None |
| A0A4Z0GMG4 | 21-120 | None |
| A0A526Z0Z4 | 2-83 | None |
| A0A4Q5X6Y8 | 58-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.