DPCstruct | MC8030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 149 ± 12 aa |
| Standard deviation of domain lengths | 12.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B2QX57 | 24-158 | QVVVDSFKVHVQDIMQPVLATYKKDAVHIRYFDPSKHGLQGSGHWFKVRNLEPVYSLDVKKNDSVMYPYIGILDVERYTEIFTGSYP… |
| A0A2G6E1X8 | 318-465 | SLVPDGNDSDVLAAILSSFESLKDTHLESLTTSAETQQKASCSRQVLLDGKGTLTYAQVVKRFSAKYTAFDVMRSPSLITPFVAELK… |
| A0A3A4N9Q2 | 18-183 | None |
| A0A354J0Y5 | 1-162 | None |
| A0A2W6ZPU1 | 1-154 | None |
| A0A081BY86 | 390-545 | None |
| R6HRM1 | 7-151 | None |
| A0A7C3E5C3 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.