DPCstruct | MC803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 7.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A290PVK0 | 1-88 | MIKIEILSSNTPEGSACDGDFSSAMFKVLSTPNNEPISQEEMQDALWNWCDDCQLNKWGRLKNSEVQAGVFLLIDLTAPENGEVIDLS |
| A0A0G4E3Y8 | 20-113 | IIIEILRSDVCPDGNLPSTLFPGAGSDGALFQVIDSRSGFPDSATICDALSDWDGDTSLVEYDEKTGRGYFRLVDSDAPAQGTVLTL… |
| A0A6P2V6U5 | 161-245 | None |
| A0A6G1W904 | 4-98 | None |
| A0A7Y1BA02 | 2-87 | None |
| F2LS63 | 2-87 | None |
| A0A3S5DRM5 | 63-148 | None |
| A0A2S3X7Z5 | 2-96 | None |
| A0A7W6Z7H6 | 82-170 | None |
| A0A0P7DN09 | 3-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.