DPCstruct | MC8029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 145 ± 29 aa |
| Standard deviation of domain lengths | 28.80 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 68.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D3A540 | 84-240 | PPKSKQPRLEKALPSSSNINFQQPSSSASSSIDEPDPEAIAQMKEMIYRAAAFRPVNLGMEVMEKPKRKNVRISTDPQTVAARQRRE… |
| A0A287UKD3 | 1-107 | KKPCGASRKTSKAKPAAATATSPKGDPQSLAAKNRREKISERLRTLQELVPNGTKVDMVTMLEKAIGYVKFLQLQVKVLATDEFWPA… |
| A0A5A7V0Q5 | 1-195 | None |
| A0A444BUU0 | 242-406 | None |
| B9EUA0 | 1-107 | None |
| A0A822Y0Y7 | 1-124 | None |
| D8RSN9 | 373-486 | None |
| A0A5N5LZN4 | 21-174 | None |
| A0A804NNR5 | 30-221 | None |
| A0A1M4I844 | 14-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.