DPCstruct | MC8027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 5.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 29.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1W3M1 | 1-77 | MESKYLDFQDVEVNRKTKLWYIKTKNNSYLGQIKWYAPWRKYCFFPADATIWDQNCLQDINDFLNGQNSLHKAELKK |
| A0A448B7Z9 | 6-86 | SEENEGRKPEYVKFHEMPFEGKTKRFMVESLNGGFNLGNIIFYPQWRTYTFQPNPNTIFDSKCLNEIINFLKSLNEDRKQN |
| A0A0F9FPH2 | 11-81 | None |
| A0A0F9VP42 | 1-88 | None |
| A0A7X7E619 | 2-76 | None |
| A0A534IA34 | 2-83 | None |
| A0A0G1C6L4 | 1-70 | None |
| A0A0F9FKK1 | 4-81 | None |
| A0A0F8ZX39 | 1-71 | None |
| A0A0F9LPU5 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.