DPCstruct | MC8026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 133 ± 8 aa |
| Standard deviation of domain lengths | 8.30 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U4E3Y2 | 13-155 | FLTANAVAYLMEQKLIVEAPKGGLILGPSHNEGGVNVFRWENDEFPIVAEFEGWEYLANPFFTAQYSQQLEAINSEFDGTAPFTEYE… |
| A0A3S4R5A7 | 29-164 | GYNFSLNDIITMKANNMIMDANDGGLVLGPLHANGGIQVLQMNEDGSFNHCTEMEGWEYITSSLITENEREELLAINEIYKNYDKNL… |
| A0A0W0N3D2 | 2-130 | None |
| A0A2J0U986 | 29-161 | None |
| A0A2N2TNM8 | 7-126 | None |
| A0A4P8RQF2 | 12-160 | None |
| A0A7Y5MYH8 | 5-138 | None |
| A0A442HYM1 | 43-171 | None |
| A0A1G8V930 | 1-122 | None |
| A0A504JLF9 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.