DPCstruct | MC8024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 14.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D9WBP4 | 2-94 | SDMSGPVHYISVATPDGQVMGYAWGDSADVGWVDRKASSVDAYKAGMEWYDANVREARERGVAPLDVLGLLSREPGVSPVTAAPDVD… |
| A0A6L9Q8M4 | 4-109 | SYDLTTTGPVRHLPVVRGDGLVLGYLWAGLHDNAAQFLPRDDAAAIGNAAMSPWVLRLRELHAGGVPAIEALERCRTFPADPTAGQV… |
| A0A841ILH6 | 105-207 | None |
| A0A7Z6T6V4 | 60-158 | None |
| A0A853BMI6 | 123-245 | None |
| A0A7M3LY20 | 1-93 | None |
| A0A243RVW1 | 1-97 | None |
| A0A2W4PQX7 | 3-114 | None |
| A0A1Q9SJX1 | 13-136 | None |
| A0A7K0DFK5 | 245-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.