DPCstruct | MC802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 10.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8DTI6 | 56-180 | QWDRAGADNLSLADWLKTDEGQKMAGLTGGIQGAEGTLFGIPYAAGSWQDRLIEAFGGTHDMIGGKVSGLYDEQGNTRRERSGHEKI… |
| A0A2P7TYK5 | 6-95 | GGFQAEQGKFAGIPYIIGSLFDYGVEGYAGMHDFSGGQIWGFYNDKGNGTRNNGKVADIAAEVITVIAIPVATPFAVSDIFSSDIFQ… |
| A0A429WLW4 | 1-110 | None |
| A0A377HTA6 | 324-426 | None |
| A0A0S4VAQ7 | 1073-1185 | None |
| A0A0S4UG47 | 560-672 | None |
| A0A2T0K807 | 94-193 | None |
| A0A2V1JZR5 | 254-344 | None |
| A0A381ECZ6 | 666-772 | None |
| A0A1V3I6J6 | 319-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.