DPCstruct | MC8015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 116 ± 16 aa |
| Standard deviation of domain lengths | 15.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5J1G1 | 4-128 | VGAWYYFDKKDNAENNLETNNQEQLIAVEKHNKEEITFPEGTDPVVKETVAQLSKHILLPTGDIKVATVTDAEEFKKQDPMRLQFVQ… |
| A0A136LY94 | 208-324 | ARPGQAESRRPFYIMVGLLTLLIVGMLAVVLIRNNQSAQPEAGLVDQVAGVAQLPLGEEPVTGKVIAAEQLKDLDADLFRYSKDGNS… |
| A0A1F4VMX2 | 22-113 | None |
| A0A2D6INV3 | 11-135 | None |
| A0A6F9ZYQ8 | 10-109 | None |
| A0A644T672 | 12-117 | None |
| A0A2J0KN81 | 50-182 | None |
| A0A0G0T0V6 | 44-157 | None |
| A0A1F8GC06 | 93-206 | None |
| A0A7T9EZH0 | 31-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.