DPCstruct | MC801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Standard deviation of domain lengths | 10.08 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 41.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376FJ23 | 1-68 | MFVELVYDKRNVEGLQGAREIILAELTKRVHQIFPDAEVKVKPMQANGLNSDASKSDREKLNRMLEEM |
| A0A3U2RZF3 | 13-92 | AIRFLLYRSIPGYFNIDGLPGAKDIILGELTKRVHRIFPDADVRVKPMMALPAINTDASKHEKEQISRTVQEMFEEAEFW |
| A0A5T5RA02 | 2-75 | None |
| A0A5U6DM17 | 1-60 | None |
| A0A485XB74 | 39-131 | None |
| A0A6C2DP38 | 52-132 | None |
| A0A2C9NW51 | 5-67 | None |
| A0A0K0H923 | 3-78 | None |
| A0A0A2VZ81 | 876-955 | None |
| A0A5U3JVT9 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.