DPCstruct | MC8009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 129 ± 8 aa |
| Standard deviation of domain lengths | 7.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y0IF24 | 175-304 | EAPTQIERVILTDEDSAIAIDISSRRFTGTSGIDNILIQEGVSVEQLNLLGGEDNVHFAGNVSDYDVSSQGTTALFTHRETGAVVEM… |
| A0A1H6R1C1 | 4-128 | KPNKAVLNGSNQDISLGFNASVVGSSGRESIQVASGVDVSITGGAGDRILLTGDAADYTFTQQGSNLLLTSGGHTITLAIGGELRLI… |
| A0A840B4H4 | 62-191 | None |
| A0A839H9G0 | 6-130 | None |
| A0A839HBI9 | 5-128 | None |
| A0A839HFN9 | 108-233 | None |
| A0A3D4XRX8 | 159-286 | None |
| A0A219B834 | 15-155 | None |
| A0A1G7NP61 | 657-791 | None |
| A0A2T2RBL5 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.