DPCstruct | MC8008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 157 ± 21 aa |
| Standard deviation of domain lengths | 21.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K7YET2 | 1-117 | MTILGDRALSSITGHGFSAVSLSRENGQDIARVALDIQSDTWTEIDSLKMGHWDNGLGPGWDQNWVGVSMGSASAELALADFVFQAC… |
| A0A1Y0IB96 | 6-158 | QLKTILISIFALLIGTICHAELKPISDDEMSNVTGQAFFSVDSYDYDGTDFMRVNLGIEIETLLDIGELEVGRYHRWENGDACLECD… |
| A0A3S0ER49 | 4-155 | None |
| A0A2E2DFV4 | 20-188 | None |
| A0A1X7AI89 | 16-151 | None |
| A0A3A4XZS7 | 15-145 | None |
| A0A077KYZ0 | 19-181 | None |
| A0A150HWR2 | 1-194 | None |
| A0A2N2J790 | 16-185 | None |
| N9LU22 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.