DPCstruct | MC8006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 186 ± 23 aa |
| Standard deviation of domain lengths | 22.55 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0YLI8 | 109-302 | VNVPDMDKSASLHVSDMRVPTEKQDKIFSLLITSKEYGVMRVGDARLSPSAVRLLQHEAFKKLGADGKPHDVTVYHFVIYQNMRAQL… |
| A0A1Y0I7L2 | 62-268 | TIGCSIQKVIVNSPGLQESLEQSENLQIKDLRPEAEKDREIFSLFILSEAYGTSRQGDMTEPPPLRILQHRIYDKYVNEARLPEVKV… |
| A0A846N2T8 | 28-195 | None |
| A0A1V3PZY1 | 2-182 | None |
| A0A4Q8U0F8 | 14-198 | None |
| A0A2E4QX17 | 14-237 | None |
| A0A7I8ECF9 | 8-185 | None |
| A0A5C8KWW0 | 1-198 | None |
| A0A0R0CBL1 | 25-234 | None |
| A0A0F3KXU4 | 2-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.