DPCstruct | MC8003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 159 ± 22 aa |
| Standard deviation of domain lengths | 22.01 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07775 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4WHP2 | 225-368 | AEKALSCLEEIAKARDFYDLMEKHLKPAKEAETIDPRGLAVEDPERSVKAVIKDVWVEWDGNRPRIVVEYEANGRTETFYLTWGAAT… |
| F2L4A9 | 39-162 | GSVKPPIEKEVEVGGRRLKVRIEEVEAGVERGGTKEHFVVRARAKASDAEKEAAVKKEVRFYKARDGAAMGYVNIHAGAEGGREADY… |
| A0A7C5X9N9 | 801-941 | None |
| A0A831YF69 | 7-141 | None |
| A0A831YID4 | 742-902 | None |
| A0A2J2HBV2 | 209-384 | None |
| Q8ZWU1 | 81-209 | None |
| Q8ZTJ6 | 174-352 | None |
| Q8ZX19 | 4-163 | None |
| Q8ZXN2 | 109-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.