DPCstruct | MC8002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 117 ± 15 aa |
| Standard deviation of domain lengths | 15.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0315 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W2A5D5 | 10-104 | RALTETAILLALATVLSLLKLFELPNGGSATPASMLPVIIVGIRWGKKWGFGAAIVYSFLQFFTGFYAISPMALVLDYLVAFGVLGF… |
| A0A7X8ZHQ3 | 1-104 | MERNESLKALIETGIFVAIALILDLIFGSIYSFPFGGSISLAMLPIFMISVKRGWKYGVAGGAIFGILQTLVKVYFLSLPQYIMDYL… |
| A0A359BCC7 | 46-165 | None |
| T0E516 | 1-128 | None |
| A0A5S9ME76 | 1-108 | None |
| A0A2V2GQY1 | 157-302 | None |
| A0A1V5ZQC3 | 14-116 | None |
| A0A1C5S553 | 14-121 | None |
| A0A356GDQ7 | 18-140 | None |
| C0WCY1 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.