DPCstruct | MC8000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 11.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9AJK0 | 1-94 | TDDEFSCRIVLDGKTIKMSTEKINELYNYDEFSPVDGSIIEFCDKFAAYMEAYLSIKHGITSGNLVDGHRDLYRRFARKKIGGIDVG… |
| A0A7X7U8F3 | 1-115 | IAEKILPLLPGEWHKEILYFAENEFADRAVINGKVKFLGSPEEISEKYNEDKFSAVDGSVLKGCDHLAAFVEAWLSRRHGITSQHLK… |
| A0A645G8T5 | 108-241 | None |
| A0A7X6ZYM4 | 1-127 | None |
| A0A7C1DLH3 | 236-362 | None |
| A0A7X8XAM1 | 94-218 | None |
| A0A7X7N9T4 | 276-400 | None |
| A0A347W0C3 | 197-322 | None |
| A0A7J4N5R3 | 60-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.