DPCstruct | MC800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 124 ± 22 aa |
| Standard deviation of domain lengths | 21.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C9SV09 | 18-121 | IFAIKYELQRGNSHSTRAAFEQALKSPACRANSELWRSYVQFSHSRKELRAKAKENFFRGLGQCPWSKDLAMEAFTTLANVMDEFEL… |
| A0A167P310 | 1-147 | MGGCDSLSFWAAAMITAPSVHEKREWLDRAIHNERMRSSSFLWRRYVELELEQGRTREAKSLLYRAVSECPWSKELHLLAFSDAMQP… |
| A0A177WVH5 | 214-355 | None |
| S4RXE9 | 1-113 | None |
| A0A6J0Y544 | 148-255 | None |
| R1EPT9 | 1-165 | None |
| A0A7R9U341 | 20-139 | None |
| A0A2K3L1C6 | 1-107 | None |
| A0A0B2SH69 | 46-177 | None |
| A0A4Y2RUQ9 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.