DPCstruct | MC80
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 9.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12585 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4AJX1 | 4-105 | FGDAKEARDEVYDGQPHESKLSHELIGSAAAFEGMRLWEKKQREEGKTVNHGLAKELLAAAVGFEVDKLVETKGLDFIDRERAKHHA… |
| A0A0K8LDI0 | 171-266 | DSDQAQAYDEYQSMPHEAKISHELIAAAASYEAAKAYEDHVAENGLPPSHEKAKEILAALAGAFIDREVETKGLDFIDRERAKMHAA… |
| A0A0G4NFR0 | 8-103 | None |
| A0A1W0X333 | 12-127 | None |
| A0A1W0X386 | 12-128 | None |
| A0A098DH10 | 53-153 | None |
| Q2U182 | 64-165 | None |
| A0A6S6VDA0 | 3-105 | None |
| D4AW93 | 3-90 | None |
| A0A6A6NUX8 | 2-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.