DPCstruct | MC8
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 6.73 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0DLY2 | 20-101 | ERIALAKERRREQLRRWEERDRSLPPARPRRQRLRFSPEVALLEATGRADAVEVERLLREGANPNSHNEDGLTPLHQCAIDD |
| A0A182NIQ0 | 1-85 | MSLDNRNTSAQFKRAEQLKRWEESEMNKKFSGIPKSPSSRRIKFSSGCIFLAACVAGDKEEVEWLLKNGADIDTANVDGLTALHQ |
| A0A6L5D174 | 143-221 | None |
| A0A448WXI2 | 59-139 | None |
| A0A7R9J3K4 | 16-105 | None |
| A0A819SYZ2 | 19-116 | None |
| A0A1I8HLJ4 | 1-96 | None |
| A0A3P7EDR9 | 24-123 | None |
| A0A6V7X2A6 | 9-91 | None |
| A0A4W4FXL2 | 5-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.