DPCstruct | MC7993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 224 ± 45 aa |
| Standard deviation of domain lengths | 45.07 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4YDX9 | 3-230 | AADVDRAGPKDYTLNIGNKVSGNKRTSTAPLFTYVNEELFKRPVYATMINVFNHSLFTPDVCKAEPPMNGFRKAAIEQMLNTWADTE… |
| A0A183GBC6 | 9-215 | DSKVTDALNKLVTLDVRLDGRTVFAYQNMASGKDFSHDNAPKPLFTSVDPTSLSGATYKAYDNLIAFYQTPDVDTQETVTPAWESSI… |
| A0A2C9K4P1 | 88-357 | None |
| A0A7M7HLE8 | 278-516 | None |
| A0A0K0E792 | 63-315 | None |
| A0A1I8HZ12 | 72-365 | None |
| A0A2B4SEF9 | 336-528 | None |
| A0A835CS28 | 708-961 | None |
| A0A2G8L6H5 | 260-501 | None |
| A0A7M5UU26 | 33-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.