DPCstruct | MC7992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 113 ± 6 aa |
| Standard deviation of domain lengths | 6.11 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7SST1 | 54-172 | VTLGRKIKTCPYYSTRALFEEAEIIFCPYNYLIDPLIREQMMIRLEDSILIFDEAHNMEDAAREAASLTVNSNQLKEVEEEIDKIME… |
| A0A5N4D1W3 | 73-181 | KKLKACPYYTARELMQDADIIFCPYNYLLDAQIRESMDINLKEQVVILDEAHNIEDCARESASYSITEVQLRFARDELDSMVNNNIR… |
| A0A2I0X3U4 | 134-239 | None |
| A0A183EZ30 | 16-121 | None |
| A0A3L6VDI8 | 1-120 | None |
| H9JTN8 | 128-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.