DPCstruct | MC799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 119 ± 19 aa |
| Standard deviation of domain lengths | 19.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507DRU3 | 12-108 | VPQPRGAITTPSAFLTAIGRSCADVSDKFKSWDHLFTATSLEMGDSLAIPVRKRKYILLWREWFKRGIEPRTIEIPKRAKKHLRLKN… |
| A0A167MY10 | 5-127 | RPSSLRSFLRPITPLRRSWHGTVSNPIPEPRPEIAMTTPEEFLKAIGHGTVDKVKVETWEGLFKLRGRDMKQAGLGIRERRYVLWAL… |
| L8HB81 | 86-187 | None |
| A0A507D1V6 | 1-140 | None |
| G4TX45 | 1-168 | None |
| A0A094GL67 | 6-101 | None |
| A0A395J7F3 | 71-184 | None |
| A0A427YVG4 | 3-121 | None |
| A0A4R0RV51 | 35-154 | None |
| A0A4S9GNT4 | 6-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.