DPCstruct | MC7988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 11.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04870 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183FY98 | 2-106 | FALHDQGEGLEKTLSLPNLLGSTGLMDHRDQQDWMDFVVETSGAADVIEKTKTKREKEAAKNNVRKVRGPDGQPIYFTKENVTKLYG… |
| A0A3P7LMA3 | 45-148 | LFSLHRDGKGEEKTMSLSHILKDLPSKEQEAWLDFIVEAAGVTDAVDKAEKVQAEISKRDLLDKDGVPLYFTKENTSEILGDTEKRK… |
| G0PFS5 | 14-133 | None |
| G0MVA0 | 1-125 | None |
| A0A158PLD4 | 62-171 | None |
| A0A0N4TBC7 | 188-308 | None |
| A0A183EH87 | 1-128 | None |
| A0A2G9TEJ9 | 36-133 | None |
| A0A0N4VV32 | 120-242 | None |
| A0A183EPX9 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.