DPCstruct | MC7986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 102 ± 12 aa |
| Standard deviation of domain lengths | 12.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8EVI7 | 144-235 | APTQAPPAPAPTQAPAPPAGVNGNPWGYNFTPGSLLYNPNADFCSYFACVSTFWTSTNGYVDECVSGKYSHSGGVSGACSRNGGELR… |
| A0A7K3X8S8 | 10-90 | GRSACRPRCGAPANPYGYNYCGGDLVYDPAPDVCDWFACATNFWDGKGYVVQCADDLLSRTGLPGGPCADHGGTRRSLYVA |
| A0A535CZJ0 | 115-226 | None |
| D6TLD8 | 89-190 | None |
| A0A7J9Y9C1 | 43-161 | None |
| A0A7W7VK30 | 128-248 | None |
| A0A535DEA8 | 21-111 | None |
| A0A810NNB8 | 312-418 | None |
| A0A535JYJ0 | 40-133 | None |
| A0A7J9ZVA3 | 285-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.