DPCstruct | MC7985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 123 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4S3D5 | 2-116 | LYERLIAESSLYFYRNREKFSHWQAVVIYPSQSIEQSDVHPHRSFLNGGQVHVVYLNKIGNIRTLPIWVALMVLTRLSEKVAPQEAK… |
| A0A845ZCD5 | 22-146 | QFQKDSKIYLRLFSEIFTYLRDNEPDLRWRAMIILKSRSMEPTERQRESVQPFLDSSLVKRIYLNEIEVSETTPLGVQIVQLVVAKK… |
| A3IYG5 | 2-124 | None |
| A0A2T1ESA3 | 65-193 | None |
| Q8YV45 | 2-127 | None |
| A0A1H2Z446 | 2-109 | None |
| A0A6I5PA82 | 67-187 | None |
| A0A6P0QLA8 | 44-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.