DPCstruct | MC7980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 189 ± 13 aa |
| Standard deviation of domain lengths | 13.11 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4RK98 | 1-165 | MEEIDLNFNSVTLTILKQSFQLYEYKKSHSCSEYRILLELRGWVKGSAKERRAIRVAKALYNHFSYCPQALGSIEPKVLYSLAQSRY… |
| A0A1Z4SZW0 | 21-189 | VESIIEFSKKLCEEKQNLSKKEWRQHLNILGWTSAVAAKYIKIGKAFETFDTSKLTQIEPSTLFKITSSKKFASVVEGIKSTIGHIT… |
| K9V2E5 | 3-199 | None |
| K9RIS9 | 19-218 | None |
| A0A1Z4Q1R1 | 3-206 | None |
| A0A1Z4PTV7 | 8-200 | None |
| A0A844MT56 | 24-218 | None |
| A0A367QAR9 | 17-225 | None |
| A0A3D1P782 | 26-218 | None |
| A0A2N6LBW6 | 10-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.