DPCstruct | MC798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 177 ± 19 aa |
| Standard deviation of domain lengths | 18.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8PQA4 | 13-168 | TKYTLKSHGIWERIRRFFAVDPNRSTGIPYVAQYRNPLPGTLPQPTYHDPVTIPSGDIADNPYWKRDNRRGFPRLSVVTQSDQAGML… |
| A0A167LCY9 | 10-182 | TKYHLAPHGFWKRFRDVAVLNPNISSGLPIPSLNRYPQPGSRPEQYATPTSKASDPAQNPYHKRDFRRAYPQLSTVSQQRMTSLLLQ… |
| A0A0F2MJS8 | 21-200 | None |
| A0A3M6WC85 | 1-162 | None |
| A0A1G4AQM0 | 64-256 | None |
| A0A0G2GZW5 | 813-984 | None |
| Q2UG23 | 35-206 | None |
| A0A1Y1WCA7 | 6-155 | None |
| A0A425BL38 | 1-152 | None |
| A0A511KED6 | 489-660 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.