DPCstruct | MC7978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 11.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.14 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0041- CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4RH28 | 1-107 | MKLSGEQRKKLHSALLDAFCSKANLEQMLWFELDKNLDAFAGGDNLQNIVFQIIKLAESEGWVEDLVCAARHFNSGNSNLKIIAEEL… |
| A0A6P0NGW6 | 5-106 | NTPGYLLKKIKNALCSAFPSEIKLAMMLDYQFSINLEEIARGGDLTDIVYKVVKDFKTRNSLENLLDGALNENPDNLHLKAIKEEFK… |
| X5V3A1 | 1-124 | None |
| A0A6P1L151 | 562-666 | None |
| A0A6P0RDY9 | 7-119 | None |
| A0A856ME80 | 15-104 | None |
| K9EIE7 | 1-112 | None |
| A0A845WIG8 | 2-109 | None |
| A0A352AB66 | 1-94 | None |
| A0A1D2P3J5 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.