DPCstruct | MC7976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 302 ± 37 aa |
| Standard deviation of domain lengths | 37.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5HS82 | 1-246 | MLFACIESLQTASDAILATPAPAKGWSKKLDAHLFVVKHLLILREQTAPYRQNVLRSDALNTKDFSIDFSKFTNVLFDSNSKWFELS… |
| W2TLP8 | 144-421 | WYPTVRRTVMCLAKLYRCLDVAVFQSLARDLLSMCCESLEEAALHISTSPSKKAGHTKNLDGELFLVKHLLILREQTTPYRQAAHRA… |
| W7U7M5 | 130-452 | None |
| A0A167CGJ2 | 607-887 | None |
| X6LNT7 | 462-762 | None |
| A0A8B6BSA0 | 203-466 | None |
| A0A5N5QM29 | 804-1063 | None |
| A0A4S4KX05 | 1-343 | None |
| A0A8B6HA91 | 43-310 | None |
| A0A7S2SLN9 | 1-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.