DPCstruct | MC7974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 215 ± 15 aa |
| Standard deviation of domain lengths | 14.78 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06542 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7TQW2 | 106-322 | IDISRKQWIDSEYFTKVRLNDPYEPFGDDSNLPKLRYVELNLRDSLLCSTDFCFLDPTKTWYRGFDNVIANIRSVFPTDQIIVKGFN… |
| A0A6A5HK97 | 19-247 | RSMMQINLEDVKNWMTKLKLNAPSESVKKSKLNLKFERVDVDLSDSEKCAIGITHNKSDWDHYKNLIANIRKEFPTDEISIRFSHWM… |
| G0M8U9 | 253-456 | None |
| G0MPM2 | 279-499 | None |
| G0N1C6 | 730-957 | None |
| O44994 | 175-367 | None |
| G0P6J5 | 157-392 | None |
| G0PHS4 | 168-388 | None |
| A0A1I7V4F9 | 34-223 | None |
| G0NND0 | 271-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.