DPCstruct | MC7972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 128 ± 28 aa |
| Standard deviation of domain lengths | 28.37 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7TAH8 | 1-104 | MNCKPLTYDSLKTVIQYLDPNTRFLLSSRIPSIRTAERAVPLIIKRLLIFNHCVDVNDVRYECVVYQVDCKDKIPYRVSGKSDLNWK… |
| A0A6A5HIZ1 | 1-103 | MNFIPLQYESLKAVLIHIDANIRFKISQRLPTIRITEKLVPLRVRSLKLDEFCTIVNDTKYQLDIYREFDSGENILQQIKMENDFGG… |
| A0A2P4WGK6 | 1-135 | None |
| A0A1I7T3S0 | 1-94 | None |
| A0A1I7T5Y8 | 1-139 | None |
| B6ILM0 | 1-104 | None |
| A0A1I7UGN1 | 1-89 | None |
| A0A1I7UPH6 | 4-186 | None |
| A8XVU9 | 207-342 | None |
| G0MDS4 | 4-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.