DPCstruct | MC7971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 345 ± 42 aa |
| Standard deviation of domain lengths | 42.32 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5U390 | 58-324 | AFVNKTVNYTSLQIIEDSKNNYWEFMKKWWSGTGAGEGSCSRCPDKKPILRLCLTCDKNRCCQRRHGANRLRLGCDVDLLNLATQVV… |
| A0A6A5HI81 | 1-321 | MAWKASSRALPASFDSRSNAFINGTVNYGSTNIIEQYESNVFQLFKKWWQQFNSGIGVCCNCLDHKLLRICMTCKKKKDLKDVDILK… |
| A0A2G5U371 | 18-353 | None |
| A0A2G5U353 | 1-367 | None |
| Q20323 | 21-391 | None |
| G0P7X4 | 1-392 | None |
| B6IGC2 | 708-1038 | None |
| A0A6A5HJ05 | 1-389 | None |
| A0A6A5HGI2 | 1-393 | None |
| G0MMW6 | 2-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.